DPCfam | MC371435
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 276 ± 30 aa |
| Residues in low-complexity regions (%) | 5.54 |
| Residues in coiled-coil regions (%) | 3.95 |
| Predicted disordered residues (%) | 25.68 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF08378 |
| Sequences matching dominant architecture (%) | 87.88 |
| Average overlap percent | 36.41 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A078M6F2 | 17-294 | 278 | VLLIIVIWFLVYYFKHRNEVKTVEQTYSKEKESLVEKYESEQEEERLEHKKEMSTLNEKYHNDTTLLDNKLSSLHQFTVDKGEYL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q2G1W5-F1 | 27-299 | 98.96 | 88.75 | View in AlphaFoldDB ↗ |