DPCfam | MC37142
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 169 ± 19 aa |
| Residues in low-complexity regions (%) | 1.72 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.63 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12952 |
| Sequences matching dominant architecture (%) | 94.44 |
| Average overlap percent | 90.33 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A085L8X6 | 5-153 | 149 | FLPAYRWMRERMQKQLPGYSGGYPVWLWHRPKPDLRRSGHLAKGSRAVLIEVLLPADRILLSDFDAWHCVLNRWFLYLSEKEEKF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0F224-F1 | 2-136 | 91.80 | 91.53 | View in AlphaFoldDB ↗ |