DPCfam | MC371057
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 72 ± 6 aa |
| Residues in low-complexity regions (%) | 1.31 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.35 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00536 |
| Sequences matching dominant architecture (%) | 92.31 |
| Average overlap percent | 27.58 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0005EDA3DB | 963-1031 | 69 | LHQSVFMSAMSPHPAKDLPLCWEQHSKLLPGVANLSAATVARWTMDEVASFVQKLPGCQEHASKFADEQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E1C2V1-F1 | 736-804 | 98.57 | 70.44 | View in AlphaFoldDB ↗ |