DPCfam | MC371010
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 101 ± 13 aa |
| Residues in low-complexity regions (%) | 1.65 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.36 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12146 |
| Sequences matching dominant architecture (%) | 86.05 |
| Average overlap percent | 16.79 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| U3B1N5 | 4-112 | 109 | ISTFLIPVIITSLTACGSNNDVPYHYQSAETLSPYQQASFEQYVLETQQWMKLERNFITDDINREIALNSPQEYRPSKPNGEAIL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GQJ2-F1 | 115-157 | 44.33 | 97.85 | View in AlphaFoldDB ↗ |