DPCfam | MC370951
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 241 |
|---|---|
| Mean domain length (aa) | 184 ± 27 aa |
| Residues in low-complexity regions (%) | 7.23 |
| Residues in coiled-coil regions (%) | 0.16 |
| Predicted disordered residues (%) | 54.62 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF08311 |
| Sequences matching dominant architecture (%) | 72.68 |
| Average overlap percent | 12.33 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| V4CNB3 | 136-301 | 166 | LGCDLSCFYEAWTATLEQVGNIQKADAIYKEGYKRIKEPPAKLEVKYQEFQARVANGTVQQNTDIEDDNPPEERTALGQLKGHGK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2ETZ5-F1 | 161-340 | 98.40 | 58.19 | View in AlphaFoldDB ↗ |