DPCfam | MC370588
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 157 ± 18 aa |
| Residues in low-complexity regions (%) | 15.12 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 70.3 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF11489 |
| Sequences matching dominant architecture (%) | 63.38 |
| Average overlap percent | 49.53 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G8BXT9 | 303-446 | 144 | KKPSSRIAAFQKMIEEQQMQNIQSSSRGVATNTSQENLNGQTTDPTTKTNNGTSSIGSKAQQLTGLFALPGMMPMGGIPDSLAKK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6FPQ4-F1 | 417-565 | 98.75 | 64.82 | View in AlphaFoldDB ↗ |