DPCfam | MC37054
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 71 ± 5 aa |
| Residues in low-complexity regions (%) | 2.5 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.07 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00152 |
| Sequences matching dominant architecture (%) | 8.33 |
| Average overlap percent | 80.59 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1G4FPN7 | 243-317 | 75 | MGIRVDKDALEKELKLADCEERKKLKYHKMILSGELPDTIGGGIGQSRICMFFLDKKHIGEVQSSFWTDEIIEEC... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0SRK2-F1 | 254-324 | 97.26 | 97.55 | View in AlphaFoldDB ↗ |