DPCfam | MC370104
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 168 ± 34 aa |
| Residues in low-complexity regions (%) | 2.72 |
| Residues in coiled-coil regions (%) | 0.41 |
| Predicted disordered residues (%) | 18.92 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09094- PF09095 |
| Sequences matching dominant architecture (%) | 80.37 |
| Average overlap percent | 53.73 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1G2ZK71 | 319-565 | 247 | FKVKYVEAALMYGRMMTVGKVVNAIGKNTQSYKSAVTELYKAQCNCAYWHGVFGGIYLPHLRNSVYTHLINAENIVEQESRNDTS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P09961-F1 | 313-459 | 99.34 | 96.15 | View in AlphaFoldDB ↗ |