DPCfam | MC369728
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 307 ± 54 aa |
| Residues in low-complexity regions (%) | 1.47 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.53 |
| Average transmembrane regions | 1.0 |
| Dominant Pfam architecture(s) | PF15149 |
| Sequences matching dominant architecture (%) | 87.5 |
| Average overlap percent | 72.62 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W5N6L5 | 748-1068 | 321 | LMKFTIGNPSLLKVTTAHSWDRANNHILNITAFSNFFQKGQTTVIVSIPEASLLCTSTPFVFTLQNSCPTGLRIRYIPDQVISAH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9H7T0-F1 | 750-1079 | 98.22 | 88.12 | View in AlphaFoldDB ↗ |