DPCfam | MC369513
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 381 |
|---|---|
| Mean domain length (aa) | 262 ± 44 aa |
| Residues in low-complexity regions (%) | 5.15 |
| Residues in coiled-coil regions (%) | 2.52 |
| Predicted disordered residues (%) | 3.2 |
| Average transmembrane regions | 5.23 |
| Dominant Pfam architecture(s) | PF10292 |
| Sequences matching dominant architecture (%) | 61.56 |
| Average overlap percent | 81.5 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0M3J3W6 | 4-242 | 239 | STLFLSIERIIATLLYRTYEKHQKQWIGILIAVIQWTFTLPIFYWENRDNGMILPYCAIELYDPALSKSIEYVQIVIQCCAIIIF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9XVP3-F1 | 47-332 | 99.65 | 86.60 | View in AlphaFoldDB ↗ |