DPCfam | MC368971
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 120 ± 15 aa |
| Residues in low-complexity regions (%) | 6.25 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 1.28 |
| Average transmembrane regions | 3.06 |
| Dominant Pfam architecture(s) | PF03595 |
| Sequences matching dominant architecture (%) | 96.83 |
| Average overlap percent | 49.3 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A164WW33 | 223-328 | 106 | EDKLWPFLLRYPISSFGLCLGISSQAIMWKNLATSTSMDFLHVSLKVNLLLWILSIAIFCVVAFIYILKIVFYFEAVRREYYHPI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B9EY47-F1 | 275-397 | 100.00 | 90.11 | View in AlphaFoldDB ↗ |