DPCfam | MC368653
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 414 ± 50 aa |
| Residues in low-complexity regions (%) | 3.61 |
| Residues in coiled-coil regions (%) | 0.07 |
| Predicted disordered residues (%) | 17.31 |
| Average transmembrane regions | 0.08 |
| Dominant Pfam architecture(s) | PF10283 |
| Sequences matching dominant architecture (%) | 10.94 |
| Average overlap percent | 5.71 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A165I8T1 | 15-461 | 447 | ILKLCDTLATVVAAAQSHRRWRNIYYEKENKDIVDRHVFVNRIGRRVAAAALCGIRIHAFMSTFRDPEPGEPSFVEIVRERFSEA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0P084-F1 | 13-205 | 49.76 | 95.30 | View in AlphaFoldDB ↗ |