DPCfam | MC368607
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 129 ± 25 aa |
| Residues in low-complexity regions (%) | 8.3 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 47.7 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B9S867 | 75-210 | 136 | CPFDVEEDVMTDPGSRPGSFDQKGHLCDPLEAGGLFPVRKSQDAAVGALVRMLKKAPPLCQDFSTSADMLQDTRSKLCNISLQEQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7L6R5-F1 | 472-617 | 99.35 | 53.57 | View in AlphaFoldDB ↗ |