DPCfam | MC368312
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 77 ± 11 aa |
| Residues in low-complexity regions (%) | 1.36 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.15 |
| Average transmembrane regions | 0.06 |
| Dominant Pfam architecture(s) | PF00514 |
| Sequences matching dominant architecture (%) | 74.32 |
| Average overlap percent | 21.78 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M3YGR8 | 320-382 | 63 | LTGLLWNLSSTDELKEELIADALPVLADRVIIPFSGWCDGNSNMSREMVDPEVFFNATGCLRN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O35116-F1 | 74-159 | 100.00 | 91.22 | View in AlphaFoldDB ↗ |