DPCfam | MC3682
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 99 ± 12 aa |
| Residues in low-complexity regions (%) | 2.87 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 41.85 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF16858 |
| Sequences matching dominant architecture (%) | 94.74 |
| Average overlap percent | 47.95 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00046BBE6C | 135-241 | 107 | ALEPVSQLKETPDPWQSLDPFSSLDSKPFKKGRPYSVPACVEEVPGQKRKRKGATKLQDFHQWYLATYANHADSRRLRKKGPSFA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6IBW4-F1 | 311-409 | 98.99 | 57.07 | View in AlphaFoldDB ↗ |