DPCfam | MC36819
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 134 ± 9 aa |
| Residues in low-complexity regions (%) | 8.48 |
| Residues in coiled-coil regions (%) | 0.47 |
| Predicted disordered residues (%) | 6.17 |
| Average transmembrane regions | 1.92 |
| Dominant Pfam architecture(s) | PF13994 |
| Sequences matching dominant architecture (%) | 92.96 |
| Average overlap percent | 94.02 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00082DFD5C | 23-158 | 136 | VIRSQRSAFRHAVDWIVTLLAWCAFLYLLVRGIMAVGSNQMQGVDMPFFSRVMPSVDTLIIYALAMVLQGLFLLVWALYNWSRFH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P69432-F1 | 4-127 | 99.28 | 71.19 | View in AlphaFoldDB ↗ |