DPCfam | MC368145
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 155 ± 34 aa |
| Residues in low-complexity regions (%) | 4.52 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.03 |
| Average transmembrane regions | 0.09 |
| Dominant Pfam architecture(s) | PF12722 |
| Sequences matching dominant architecture (%) | 78.31 |
| Average overlap percent | 26.17 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| S9QYA7 | 250-418 | 169 | NRTEVLRLIMILISNRVYQDEESNSHTLTYLTYFSNKQFSLIFLYSLINTAINLRAESRKIAYSNLLSNDASGSLSKLACQVLLI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0E9B5-F1 | 194-362 | 99.45 | 86.39 | View in AlphaFoldDB ↗ |