DPCfam | MC367891
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 1092 ± 162 aa |
| Residues in low-complexity regions (%) | 13.56 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 80.93 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W9YP82 | 360-1426 | 1066 | SRASGMLMKQPSIVREDWEGEQNEGISPRGIQQPSEDTLDSVNGGQTPQSKRAGNAANVSRKIEEPTVPPKTVNQLVTSSSNMQD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7PX65-F1 | 583-1919 | 96.36 | 40.31 | View in AlphaFoldDB ↗ |