DPCfam | MC367846
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 182 ± 15 aa |
| Residues in low-complexity regions (%) | 1.17 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.1 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14620 |
| Sequences matching dominant architecture (%) | 74.07 |
| Average overlap percent | 28.75 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1K1TKK9 | 253-441 | 189 | GDFPVYSISFEGKNGPCNLDLTRTEGHVTWMLYNRPVKESKLNREQALEKAQSFLKKMGYEGMVPISHIEDDHVLTLSMVHKEGN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9RC82-F1 | 257-437 | 98.37 | 94.38 | View in AlphaFoldDB ↗ |