DPCfam | MC367736
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 164 ± 19 aa |
| Residues in low-complexity regions (%) | 2.79 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.54 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF01078 |
| Sequences matching dominant architecture (%) | 5.15 |
| Average overlap percent | 15.82 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A176EWB0 | 25-189 | 165 | QPPPPPKGLEDMKLPIVMMRDILIKTMFRKNIDTVSDLAEAICLPRAVTQELMDMARSQSMVEAMGTMSATAGSEMGYQLTDSGK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P34732-F1 | 288-334 | 28.32 | 83.20 | View in AlphaFoldDB ↗ |