DPCfam | MC367260
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 381 |
|---|---|
| Mean domain length (aa) | 327 ± 35 aa |
| Residues in low-complexity regions (%) | 3.63 |
| Residues in coiled-coil regions (%) | 0.02 |
| Predicted disordered residues (%) | 18.04 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF05088 |
| Sequences matching dominant architecture (%) | 98.75 |
| Average overlap percent | 27.08 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0D8HHJ6 | 451-783 | 333 | WYDKLEEELFNRHGDRLGTTLAHRYGNVFDGAYRNDYSARIGADDVDRIESALETDGIWVGFTSEVDRHPLIELRSNIDIRLRII... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E1V4J5-F1 | 519-826 | 99.67 | 88.96 | View in AlphaFoldDB ↗ |