DPCfam | MC367196
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 64 ± 7 aa |
| Residues in low-complexity regions (%) | 2.58 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.97 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02782 |
| Sequences matching dominant architecture (%) | 69.77 |
| Average overlap percent | 4.72 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0003090089 | 243-314 | 72 | KSASEGGCWGMACLAMYMDKKDDYKSLDDFLEKFLFANQSKYTELADDKIIKSFDKFLNDYKKYLPIQRFAD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A132Z962-F1 | 468-529 | 98.44 | 94.78 | View in AlphaFoldDB ↗ |