DPCfam | MC367190
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 258 ± 28 aa |
| Residues in low-complexity regions (%) | 16.27 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 48.04 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06605 |
| Sequences matching dominant architecture (%) | 3.33 |
| Average overlap percent | 2.4 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| D8JAW4 | 369-605 | 237 | YRAYSQGVSAGGGGILSETSGDNADFESVVDSQIDSVFQGTDNAWQEIGSFTTDEDTSMLFVSVRAQREGTTGSDDLGGTYIRLH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P76072-F1 | 961-1097 | 51.20 | 49.16 | View in AlphaFoldDB ↗ |