DPCfam | MC366702
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 76 ± 12 aa |
| Residues in low-complexity regions (%) | 0.0 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.24 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14883 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 19.74 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B5JTX9 | 601-670 | 69 | KILFELQAKQWHKDNAPVPAEELARQMQAFKARGFQNYGYYPDDFIAGQPEMDIIRPHLSTTDYPHMRR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8XAR3-F1 | 590-670 | 100.00 | 91.11 | View in AlphaFoldDB ↗ |