DPCfam | MC366694
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 438 ± 49 aa |
| Residues in low-complexity regions (%) | 6.36 |
| Residues in coiled-coil regions (%) | 0.15 |
| Predicted disordered residues (%) | 8.45 |
| Average transmembrane regions | 0.19 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000905A345 | 22-445 | 424 | LYERAHYRHDPCWLLPVPPRLCLACVLELLPEPCVSLVRKKHVLSCFRDALLRHASLVMQLVAQDQRICTHFISMLFGLLCNVED... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5TIA1-F1 | 30-479 | 99.33 | 87.39 | View in AlphaFoldDB ↗ |