DPCfam | MC366654
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 77 ± 11 aa |
| Residues in low-complexity regions (%) | 2.39 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 6.77 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF03378 |
| Sequences matching dominant architecture (%) | 6.67 |
| Average overlap percent | 37.85 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0A9DAN2 | 217-296 | 80 | VIANVLYYNPSLALEKLHTLGVATEIFNLWFVMLQQVKKSGQRANFKREYAKKACCLGLTSLIGLPASHIPGEALERIFK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2G630-F1 | 799-869 | 97.26 | 91.07 | View in AlphaFoldDB ↗ |