DPCfam | MC366504
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 90 ± 5 aa |
| Residues in low-complexity regions (%) | 2.58 |
| Residues in coiled-coil regions (%) | 0.2 |
| Predicted disordered residues (%) | 16.6 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF18593 |
| Sequences matching dominant architecture (%) | 96.18 |
| Average overlap percent | 94.51 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B8YLC3 | 4-87 | 84 | ENIRYLLGCYFHQDWDCEAPTDEGIMKLFVEKEQTEKVMLLKKEFEEILNSSEELTENFLYENNGYYSPSEDGLTVLQWFKKLN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P40738-F1 | 13-90 | 89.01 | 96.41 | View in AlphaFoldDB ↗ |