DPCfam | MC366031
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 145 ± 19 aa |
| Residues in low-complexity regions (%) | 5.6 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.84 |
| Average transmembrane regions | 0.2 |
| Dominant Pfam architecture(s) | PF05277 |
| Sequences matching dominant architecture (%) | 13.33 |
| Average overlap percent | 4.93 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H0X8X6 | 19-166 | 148 | ASEGEPHLPTGRELAEANRFAYAALCGVSLSQLFPEPEQSSFCTEFVTGLVKWLQLSEAVLPTMTAFASGLGGEGADVFAQILLK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A3P7GC03-F1 | 49-197 | 99.31 | 87.89 | View in AlphaFoldDB ↗ |