DPCfam | MC365974
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 88 ± 6 aa |
| Residues in low-complexity regions (%) | 5.09 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.39 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF16542- PF16536 |
| Sequences matching dominant architecture (%) | 78.26 |
| Average overlap percent | 32.81 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0J9EFE1 | 761-852 | 91 | LRGDKGLIQPAMKVRGRDYLRIIYGPDYDFPENIERLRQRGLGRKFSLAEREFKLGFEGLNRFVEGRPLSKVHECALAVLALESE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0ESC9-F1 | 780-864 | 98.84 | 92.81 | View in AlphaFoldDB ↗ |