DPCfam | MC365607
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 331 |
|---|---|
| Mean domain length (aa) | 69 ± 6 aa |
| Residues in low-complexity regions (%) | 7.76 |
| Residues in coiled-coil regions (%) | 33.33 |
| Predicted disordered residues (%) | 34.18 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04325 |
| Sequences matching dominant architecture (%) | 87.03 |
| Average overlap percent | 67.64 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A061CPT3 | 4-78 | 75 | DHHPLVHDFPELRNELQRLRQSDEQFSRLAEEYEALDKRICRIEDGIELLDDVALSALKLNRVAMKDELARQLKR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5F8C2-F1 | 1-67 | 98.53 | 86.81 | View in AlphaFoldDB ↗ |