DPCfam | MC365393
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 431 ± 66 aa |
| Residues in low-complexity regions (%) | 8.35 |
| Residues in coiled-coil regions (%) | 0.49 |
| Predicted disordered residues (%) | 30.92 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12108- PF16837- PF12171- PF11931 |
| Sequences matching dominant architecture (%) | 16.18 |
| Average overlap percent | 92.43 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A150GGA3 | 21-512 | 491 | MKIYEDEDRARREEIEALGGEDKVFSKFYDRLKEIREYHRKFPSLDLTEAEDDTPLLKEEPHVEFTGEEGLGRYLDLHDLYLRFL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1C1CHS2-F1 | 57-543 | 99.77 | 77.96 | View in AlphaFoldDB ↗ |