DPCfam | MC36523
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 70 ± 8 aa |
| Residues in low-complexity regions (%) | 1.67 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 0.32 |
| Average transmembrane regions | 1.83 |
| Dominant Pfam architecture(s) | PF01553 |
| Sequences matching dominant architecture (%) | 5.71 |
| Average overlap percent | 3.44 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A088AHM2 | 19-84 | 66 | TFVKCIARTSFVIINNIYCIPTYVVWMTLLFPVKVYQPQVYWRIEGLFFHWLLAMVSMWTWSAGYD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5TZG1-F1 | 15-84 | 98.59 | 97.07 | View in AlphaFoldDB ↗ |