DPCfam | MC365115
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 252 ± 23 aa |
| Residues in low-complexity regions (%) | 2.34 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 39.62 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00620 |
| Sequences matching dominant architecture (%) | 4.76 |
| Average overlap percent | 31.95 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1S3QK04 | 51-305 | 255 | TSSEEQKKIHKAMSSGDLAKVDTIRKNAQSDGRVRGKMRFWGKTKQGEKKSSREKLFCGGDSMDADDGDTGPLLGEAGQDYMSPP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E7EZG2-F1 | 1723-1971 | 98.82 | 49.74 | View in AlphaFoldDB ↗ |