DPCfam | MC364962
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 230 ± 25 aa |
| Residues in low-complexity regions (%) | 24.36 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 1.41 |
| Average transmembrane regions | 6.12 |
| Dominant Pfam architecture(s) | PF00528 |
| Sequences matching dominant architecture (%) | 89.58 |
| Average overlap percent | 15.59 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0S7ZH26 | 5-243 | 239 | LLSLGFPFLTLKPNRLAQGSAFSLWNVLPPVEILVLLLPWIVLIALVLIISERPFYPLLVGVVANVAVLTVFLLVGRSAERLMIG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8ZNM9-F1 | 26-256 | 99.15 | 94.35 | View in AlphaFoldDB ↗ |