DPCfam | MC364748
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 461 |
|---|---|
| Mean domain length (aa) | 281 ± 64 aa |
| Residues in low-complexity regions (%) | 2.59 |
| Residues in coiled-coil regions (%) | 0.93 |
| Predicted disordered residues (%) | 14.61 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF10602- PF01399 |
| Sequences matching dominant architecture (%) | 74.19 |
| Average overlap percent | 86.2 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A094F2Y0 | 91-416 | 326 | DAQWVTSMEKQNKVEGARLEAELKGYKNNLIKESIRIGNEDCGKFYQSIGNLQKAYEAYQRMRQDAIINKHIIELNKHLTTITIE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1KIH3-F1 | 127-429 | 100.00 | 94.14 | View in AlphaFoldDB ↗ |