DPCfam | MC364422
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 701 |
|---|---|
| Mean domain length (aa) | 104 ± 11 aa |
| Residues in low-complexity regions (%) | 2.5 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.88 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03764 |
| Sequences matching dominant architecture (%) | 78.34 |
| Average overlap percent | 84.89 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J5D9Y0 | 488-590 | 103 | RVQGKHKKQSGGRGQYGDVWIAFEPLPGGDFEFVDAIVGGVVPKNFIPAVEKGLQEARKHGVIAGFQTIGFRASLDFGSYHDVDS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q3A9R2-F1 | 491-597 | 98.17 | 90.26 | View in AlphaFoldDB ↗ |