DPCfam | MC36433
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 391 ± 37 aa |
| Residues in low-complexity regions (%) | 2.88 |
| Residues in coiled-coil regions (%) | 0.35 |
| Predicted disordered residues (%) | 20.98 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF01553 |
| Sequences matching dominant architecture (%) | 61.67 |
| Average overlap percent | 33.75 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F5YLP9 | 27-431 | 405 | ITFLMKILMRPYLFLFFGVARVFLGGKKHFFGAFERALRGDTRCIMAFRHPNGGEPQLLTWFILFRLGALAKKEGIAFAKRPRAL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0ETP4-F1 | 36-123 | 23.65 | 86.52 | View in AlphaFoldDB ↗ |