DPCfam | MC364219
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 239 ± 41 aa |
| Residues in low-complexity regions (%) | 5.21 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.69 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00017 |
| Sequences matching dominant architecture (%) | 33.33 |
| Average overlap percent | 30.01 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F1RVF6 | 23-269 | 247 | ALPLYFEGFLLVKRSEYQEYKHYWTELRGTTLFFYTDKKSTIYTDKLDIIDLTCLTDQNTEKIVQSSPLFAKEEVQLKTENTESG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q7T2F4-F1 | 20-269 | 99.61 | 83.94 | View in AlphaFoldDB ↗ |