DPCfam | MC364015
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 67 ± 5 aa |
| Residues in low-complexity regions (%) | 8.67 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.4 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q6VY39 | 5-74 | 70 | RLGAGAGGWTPYTPTFTASGGGAALGNGLMDAEYTLNGDECHLRISFVAGSSTTFGTGGLRWGLPFTAAA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P44242-F1 | 500-556 | 87.69 | 94.18 | View in AlphaFoldDB ↗ |