DPCfam | MC364008
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 89 ± 12 aa |
| Residues in low-complexity regions (%) | 0.31 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.14 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02351 |
| Sequences matching dominant architecture (%) | 97.37 |
| Average overlap percent | 73.53 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000443450F | 418-516 | 99 | ARLADFQEACQPSLLAPNRCIREDSPRCLRAYTGILGTPITPNYVGNVSTAVAPWCSCRSSGNRLEECETFLGLFVGNPCLQNAI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P56159-F1 | 258-350 | 98.94 | 92.21 | View in AlphaFoldDB ↗ |