DPCfam | MC36381
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 96 ± 21 aa |
| Residues in low-complexity regions (%) | 3.51 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.85 |
| Average transmembrane regions | 0.42 |
| Dominant Pfam architecture(s) | PF08589 |
| Sequences matching dominant architecture (%) | 48.59 |
| Average overlap percent | 21.4 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0G4M6Y7 | 78-142 | 65 | MPDLRFEQSYLNSLAKAQSWQGVAWITTRDQVLMPLVQGVVYNLFLLGWQSWNRNAQIHGSSVGA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175WA63-F1 | 82-156 | 100.00 | 69.06 | View in AlphaFoldDB ↗ |