DPCfam | MC363809
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 69 ± 8 aa |
| Residues in low-complexity regions (%) | 0.49 |
| Residues in coiled-coil regions (%) | 0.24 |
| Predicted disordered residues (%) | 25.12 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00924 |
| Sequences matching dominant architecture (%) | 96.0 |
| Average overlap percent | 21.42 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0H3X1W7 | 466-547 | 82 | LVLQRALSDFYIEYDLHVAPVNPVQRLVMLSELHSQIVDVFNEFGVQIMSPHFEEQPEAPVVIAPGGWAPAPAMPQSDPGET... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GMV6-F1 | 460-529 | 98.59 | 88.44 | View in AlphaFoldDB ↗ |