DPCfam | MC36370
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 261 |
|---|---|
| Mean domain length (aa) | 82 ± 10 aa |
| Residues in low-complexity regions (%) | 3.48 |
| Residues in coiled-coil regions (%) | 0.15 |
| Predicted disordered residues (%) | 30.17 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF11924 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 29.92 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009DFC130 | 120-189 | 70 | AKSYALGKFNSTIASEAQKWLSQFGTAKINFGLDRKGKLENNSLDLLLPLYDNKTDWLLFSQLGYRNKDS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P36943-F1 | 69-152 | 97.67 | 85.63 | View in AlphaFoldDB ↗ |