DPCfam | MC3636
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 147 ± 27 aa |
| Residues in low-complexity regions (%) | 17.6 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 64.05 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07653 |
| Sequences matching dominant architecture (%) | 2.22 |
| Average overlap percent | 21.31 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A6NHU9 | 488-642 | 155 | SPFAAAIAGAVRDREKRLEARRNSPAFLSTDLGDEDVGLGPPAPRTRPSMFPEEGDFADEDSAEQLSSPMPSATPREPENHFVGG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q52KW0-F1 | 525-676 | 98.59 | 53.59 | View in AlphaFoldDB ↗ |