DPCfam | MC363322
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 270 ± 47 aa |
| Residues in low-complexity regions (%) | 2.11 |
| Residues in coiled-coil regions (%) | 0.1 |
| Predicted disordered residues (%) | 17.09 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A022QUE8 | 86-367 | 282 | PEKENWNLPLDEIDETHCHYLYGLIHCNGYGHLIRVNGLKNNSNFFSADDTMEFWDRLCTVLKSRYISARHVSRKEAIELSLIHG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R0GFU6-F1 | 111-425 | 100.00 | 79.65 | View in AlphaFoldDB ↗ |