DPCfam | MC363307
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 66 ± 5 aa |
| Residues in low-complexity regions (%) | 3.33 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.52 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F3NWA7 | 556-618 | 63 | LKDKNLMEKTEAHIHNIGLVGEEEKGLLLFFILLTRMFKEPLHALVQGKSGSGKTYLLKKIAG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q97X60-F1 | 296-331 | 52.17 | 95.16 | View in AlphaFoldDB ↗ |