DPCfam | MC3633
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 237 ± 23 aa |
| Residues in low-complexity regions (%) | 9.12 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 40.92 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF00226 |
| Sequences matching dominant architecture (%) | 89.74 |
| Average overlap percent | 19.23 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0004E582B4 | 1-226 | 225 | MNHAIRAAVFGPRAASPSTTSVSFFHSTPVLERKRRTNWHSSWRDEDERNARNDGAPWFRRHYWARGTKKSGFCVHEPQSEDYRN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7LDB8-F1 | 53-290 | 98.44 | 64.85 | View in AlphaFoldDB ↗ |