DPCfam | MC363164
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 188 ± 35 aa |
| Residues in low-complexity regions (%) | 4.98 |
| Residues in coiled-coil regions (%) | 38.28 |
| Predicted disordered residues (%) | 32.0 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07996 |
| Sequences matching dominant architecture (%) | 2.22 |
| Average overlap percent | 79.82 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0X3R565 | 33-273 | 241 | LGSMVMFSTTSVSAGGYPVFDLSNLMQALKDFAQGKAQMKADGLEYAAQVTRWRRTFQEYQNALVQIQGMINNFGLPPGATLERV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7LLC9-F1 | 146-206 | 31.31 | 79.33 | View in AlphaFoldDB ↗ |