DPCfam | MC362810
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 3681 |
|---|---|
| Mean domain length (aa) | 321 ± 42 aa |
| Residues in low-complexity regions (%) | 13.03 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 1.71 |
| Average transmembrane regions | 8.35 |
| Dominant Pfam architecture(s) | PF01098 |
| Sequences matching dominant architecture (%) | 92.59 |
| Average overlap percent | 91.54 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| L5MZ93 | 8-191 | 184 | GARLRHLIGLGGPVVTVAFLGYITLKPHALNRINSYINPWNDPSGTGYNIIQSWIAIAHGGLSGTGFGKSIQKYLYLPEMHTDFI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P07373-F1 | 49-363 | 99.61 | 89.75 | View in AlphaFoldDB ↗ |