DPCfam | MC3626
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 241 |
|---|---|
| Mean domain length (aa) | 418 ± 59 aa |
| Residues in low-complexity regions (%) | 3.96 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.25 |
| Average transmembrane regions | 0.11 |
| Dominant Pfam architecture(s) | PF00010 |
| Sequences matching dominant architecture (%) | 0.48 |
| Average overlap percent | 2.56 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0V0YKX5 | 729-1195 | 467 | LSFHVKILHSVISRLEVPTEIEEAERGGFCITDVQGNLRIRHPAAELYGMMFPTLFTFLRCLKGLYSISSMNVVHSTYNKAKLFD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HAV4-F1 | 721-1169 | 99.76 | 84.37 | View in AlphaFoldDB ↗ |